SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016394 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016394
Domain Number 1 Region: 83-332
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.14e-51
Family ADP-ribosylglycohydrolase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016394   Gene: ENSCJAG00000008966   Transcript: ENSCJAT00000017339
Sequence length 342
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:77312746:77320055:-1 gene:ENSCJAG00000008966 transcript:ENSCJAT00000017339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGGAGPGSRLGSEIRLNPAAKLRYGGARRHPKDLGTVPEPATPAPPLPPRHQPASPPTSS
PGLFPSPGSPRRALGPRVPLPATAGNASMHNALQLKPDKPNGWRIPFNSHEGGCGAAMRA
MCIGLRFPHPSQLDTLIQVSIESGRMTHHHPTGYLGGLASALFTAYAVNGRPPLQWGKGL
MELLPEAKKYIVQSGYFAEENLQHWSYFQTSWENYLKLRGILDGESAPVFPEPFGVKERD
EFYTSVSYSGWGGSSGHDAPMIAYDALLASGDSWKELAHRAFFHGGDSDSTAAIAGCWWG
VLNGFKGVSPSNYEGLEYRNRLEETARALYSLGSKEDTVTSL
Download sequence
Identical sequences F6ZNL6
ENSCJAP00000016394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]