SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016437 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016437
Domain Number 1 Region: 350-421
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.5e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016437   Gene: ENSCJAG00000008953   Transcript: ENSCJAT00000017382
Sequence length 1177
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:65138372:65165853:1 gene:ENSCJAG00000008953 transcript:ENSCJAT00000017382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDELPFSEAVLEQALSEPCDLDAALLTDIEGEVGAGRGKASRLDAPRAGADRGAMECTFE
DMLQLINNQDSDFPGLFDPPYAGGEAGSTDPASPDPSSPASLSPPPATLSSSLEGFLSGP
EAAPSPLSPPQPAPAPLKMYPPVPTFSPGPGIKEESVPLSILQPPTPQPLPGALLPQSFP
APAPPQFSSTPVLGYPSPAGSFSKGSPPGSTQQPLPGLPLASPPGVPPVSLHTQVQSAAP
QQLLTVTAAPTAAPATTTVTSQIQQVPVLLQPHFIKADSLLLTTMKTDGATVKAAGLGPL
VSGATVQTGPLPTLVSGGTILATVPLVVDADKLPINRLAAGSKAPGSAQSRGEKRTAHNA
IEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTA
VHKSKSLKDLVLACGGGGSTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGS
GGSGSDSEPDSPVFDDSQAKPEQRPTAHSGGMLDRSRLALCTLVFLCLSCNPLASLLGAR
GLPSPSETTSIYHIPGRNVLGTESRDGPGWAQWLLPPVVWLLNGLLVLVSLVLLFVYGEP
VTRPHSDPAVHFWRHRKQADLDLARGDFAQAAQQLWLALRALGRPLPTSHLDLACSLLWN
LIRHLLQRLWVGRWLAGRAGGLQRDCSLRVDARASARDAALVYHKLHQLHTMGKYTGGHL
TATNLALSALNLAECAGDAVSVVTLAEIYVVAALRVKTSLPRALHFLTRFFLSSARQVCL
AQSGSVPLAMQWLCHPVGHRFFVDGDWAVLSTPRESLYSLAGNPVDPLAQVTQLFREHLL
ERALNCVAQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPTCSFSISSSMATTTGVD
PVAKWWASLTAVVIHWLRRDEEAAEQLCPLVEHLPRVLQESERPLPRAALHSFKAARALL
GCAKAESGPASLTICEKASGYLQDSLATTPAGSSLDKAVQLFLCDLLLVVRTSLWHQQQP
PAPAPAGQGASSGPQASALELRGFQRDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASP
ARTHQLLDRSLRRRAGPGGKGGVATELEPRPTRREHAEALLLASCYLPPGFLSAPGQRIG
MLAEAARTLEKLGDRRLLHDCQQMLMRLGGGTTVTYS
Download sequence
Identical sequences F6Y2V6
ENSCJAP00000016457 ENSCJAP00000016437 XP_002747925.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]