SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016463 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016463
Domain Number 1 Region: 28-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.03e-80
Family Carbonic anhydrase 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016463   Gene: ENSCJAG00000008976   Transcript: ENSCJAT00000017409
Sequence length 290
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:12706808:12800899:-1 gene:ENSCJAG00000008976 transcript:ENSCJAT00000017409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLSFIEDTVAFPEKEDDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREAR
YDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWG
RENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLK
AVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPL
TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Download sequence
Identical sequences A0A2K5CJQ4 A0A2K5QY34 A0A2K6T3E5 F6W8S5
XP_002758982.1.60252 XP_003935568.1.74449 XP_012319158.1.9421 XP_017403049.1.71028 ENSCJAP00000016463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]