SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016468 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016468
Domain Number 1 Region: 95-153
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.7e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016468   Gene: ENSCJAG00000008997   Transcript: ENSCJAT00000017414
Sequence length 337
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:24479983:24483456:1 gene:ENSCJAG00000008997 transcript:ENSCJAT00000017414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTLPFDESVVMPESQMCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEE
EEEDREEEDENGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKV
VPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGC
LQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAY
ESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPL
GQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN
Download sequence
Identical sequences A0A090N7T3 A0A0D9SE15 A0A1U7SP38 A0A286ZW31 A0A2I3NC11 A0A2K5JH04 A0A2K5XD82 A0A2K6AMX6 A0A2K6SE24 E2R3T3 F6W8J2 F7GSL5 G1RZ06 G3SJZ7 G7P0G5 H2PMG4 H2QUE0 M3WSY8 Q4R5G6 Q96NK8 S9WT22
ENSNLEP00000018483 ENSP00000297142 NP_001247503.1.72884 NP_001271786.1.63531 NP_073565.2.87134 NP_073565.2.92137 XP_001166748.1.37143 XP_002751474.1.60252 XP_002818126.1.23681 XP_003270545.1.23891 XP_003833438.1.60992 XP_003935237.1.74449 XP_004045321.1.27298 XP_004463362.1.11602 XP_004762650.1.14098 XP_006187803.1.101512 XP_006201929.1.17985 XP_006742668.1.47382 XP_006887678.1.29581 XP_006929353.1.62641 XP_007979868.1.81039 XP_008049624.1.4292 XP_008684682.1.72690 XP_010986358.1.51371 XP_011729659.1.29376 XP_011781081.1.43180 XP_011827576.1.47321 XP_016812724.1.37143 XP_019299282.1.44245 XP_019581766.1.88060 XP_020934874.1.46622 XP_021545442.1.83697 XP_539504.1.84170 ENSMMUP00000029891 ENSCJAP00000016468 ENSPTRP00000032555 ENSPTRP00000032555 ENSGGOP00000016982 ENSDNOP00000016389 ENSCAFP00000004656 9361.ENSDNOP00000016389 9544.ENSMMUP00000029891 9598.ENSPTRP00000032555 9600.ENSPPYP00000019801 9606.ENSP00000297142 9615.ENSCAFP00000004656 ENSMMUP00000029891 ENSP00000297142 ENSCJAP00000016465 ENSCAFP00000004656 ENSNLEP00000018483 ENSPPYP00000019801 ENSP00000297142 ENSFCAP00000017474 ENSPPYP00000019801 ENSGGOP00000016982 ENSDNOP00000016389 gi|27475985|ref|NP_073565.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]