SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016671 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016671
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily EF-hand 3.81e-19
Family S100 proteins 0.0000758
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016671   Gene: ENSCJAG00000009092   Transcript: ENSCJAT00000017623
Sequence length 90
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:7446112:7447964:-1 gene:ENSCJAG00000009092 transcript:ENSCJAT00000017623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDL
DRNKDQEVNFQEYVTFLGALALIYNEALKG
Download sequence
Identical sequences A0A2K5C4S5 A0A2K5PHR1 A0A2K6TJ83 F6W664
ENSCJAP00000016671 XP_002760026.1.60252 XP_008982676.1.60252 XP_010327959.1.74449 XP_010327960.1.74449 XP_012293724.1.9421 XP_017368786.1.71028 XP_017368787.1.71028 ENSCJAP00000016671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]