SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016795 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016795
Domain Number 1 Region: 306-479,511-677
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.27e-82
Family YicI catalytic domain-like 0.00052
Further Details:      
 
Domain Number 2 Region: 61-304
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-40
Family YicI N-terminal domain-like 0.0058
Further Details:      
 
Domain Number 3 Region: 680-776
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.23e-16
Family Putative glucosidase YicI, domain 3 0.0064
Further Details:      
 
Domain Number 4 Region: 35-89
Classification Level Classification E-value
Superfamily Trefoil 0.000000000131
Family Trefoil 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016795   Gene: ENSCJAG00000009129   Transcript: ENSCJAT00000017755
Sequence length 909
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:129408477:129425677:1 gene:ENSCJAG00000009129 transcript:ENSCJAT00000017755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLDGSSPVLKETHSAHQQGASRPGPRHYPGRSRAAPTHCDIPPNNRFDCAPDKTITQEQC
EARGCCYIPAEQALQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKD
ILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPRVHSRAPSPLYSVEFSEEPFGLIVR
RELGGRVLLNTTVAPLFFADQFLQLSTSLPSQLITGLAEHLSPLMLSTSWTKITLWNRDL
APTPGANLYGSHPFYLVLEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYVFL
GPEPKSVVRQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAYFPLDVQWN
DLDYMDARRDFTFNRDGFLDFPAMVRELHEGGRHYVMLVDPAISSSGPAGSYRPYDEGLQ
RGVFITNETGQPLIGKVWPGSTAFPDFTNPEALAWWEDMVVEFHNQVPFDGMWIDMNEPS
NFIRGSEVGCPSNELENPPYMPGVVGGALQAATNHLCSSRQFLSTLQLHNLYGLTEAIAS
HRALVKARGMRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVSEILQFNLLGVPLVG
ADICGFLGNTSEELCVRWTQLGAFYPFMRNHNGLLNLPQEPYRFSEPAQQAMRKALALRY
ALLPHLYTLFHLAHIGGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKTEV
TGYFPSGTWYNLQTVPIEALGSLPPPPKTHCEPAIHSEGQWVTLPAPLDTINVHLRAGYI
IPLQGPGLTTTESRRLPMALAVALTTGGEARGELFWDDGESLGVLERGAYTQVTFLARSN
TIMNELVHVISEGAGLQLQKVTVLGVATAPQQVLANGVPVSNFTYSPDTKVLDIPVSLSM
GEQFLIRWS
Download sequence
Identical sequences F7A375
ENSCJAP00000016795 ENSCJAP00000016795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]