SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016830 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016830
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000102
Family Voltage-gated potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016830   Gene: ENSCJAG00000009181   Transcript: ENSCJAT00000017795
Sequence length 172
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:100813772:100850059:-1 gene:ENSCJAG00000009181 transcript:ENSCJAT00000017795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIIICLVVLDALLVLAELILDLKIIQPDKNNYAAMVFHYMSIAILVFFMMEIIFKLYVFR
LEFFHHKFEILDAVVVVVSFVLDIVLLFREHEFEALGLLILLRLWRVARIINGIIISVKT
RSERQLLRLKQMNVQLAAKIQHLIECQCSFHEQEIERLNRLLRQHGLLSEVN
Download sequence
Identical sequences F6Y021
ENSCJAP00000016830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]