SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016833 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016833
Domain Number 1 Region: 67-148
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 5.1e-21
Family Band 7/SPFH domain 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000016833
Domain Number - Region: 163-276
Classification Level Classification E-value
Superfamily ALDH-like 0.0232
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016833   Gene: ENSCJAG00000009137   Transcript: ENSCJAT00000017799
Sequence length 311
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:136825602:136829366:-1 gene:ENSCJAG00000009137 transcript:ENSCJAT00000017799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARAARGTGALLLRGSLQASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRVEAERRKRATVLESEGTRESAINVAEGKKQAQ
ILASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSA
FSKLAKDSNTILLPSNPGDVTSMVAQAMGVYGALTKAPAPGDPHSVSSGSSRDVQSTDAS
LDEELDRVKLS
Download sequence
Identical sequences F6XZZ8
ENSCJAP00000016833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]