SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016843 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016843
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily ALDH-like 3.4e-41
Family ALDH-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016843   Gene: ENSCJAG00000009199   Transcript: ENSCJAT00000017810
Sequence length 171
Comment pep:known scaffold:C_jacchus3.2.1:ACFV01174829.1:39492:49856:-1 gene:ENSCJAG00000009199 transcript:ENSCJAT00000017810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YGPLHTKQAVGMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTET
FAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTS
GAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences A6MKQ3
ENSCJAP00000016843 ENSCJAP00000016843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]