SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016880 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016880
Domain Number 1 Region: 12-126
Classification Level Classification E-value
Superfamily POZ domain 8.37e-31
Family BTB/POZ domain 0.00094
Further Details:      
 
Domain Number 2 Region: 409-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000231
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 388-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000187
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016880   Gene: ENSCJAG00000009215   Transcript: ENSCJAT00000017849
Sequence length 517
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:33099824:33114606:-1 gene:ENSCJAG00000009215 transcript:ENSCJAT00000017849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGTTMEKGGNIQLEIPDFSNSVLSHLNQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPY
FRDHMSLNEMSTVSISVIKNPTVFEQLLSFCYTGRICLQLADIISYLTAASFLQMQHIID
KCTQILEGIHFKINVAEVEAELSQTRTKHQERPPESHRVTPNLSHSLSPRHNTPKGNRRG
QVSAVMDIRELSPPEESTSPQIIEPSSDVESREPILRINRAGQWYVETGVADRGGRSDDE
VRVLGAVHIKTENLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSVGQNILEHRTSYP
PIKKFRSNITSPLCSSSNRFSPSGSVVPLTERHRARKGDGISVHLRKVLSRFLVQVEESA
MMGVSGYVEYLREQEVSERWFRYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRMC
GKKYTRKDQLEYHIRKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPGCIPLEGPHSISP
ETTVTSRGQAEEESPSQEETVAPGEAVQGSVSTTGPD
Download sequence
Identical sequences F6WPG3
ENSCJAP00000016915 ENSCJAP00000016880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]