SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000017255 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000017255
Domain Number 1 Region: 268-584
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.1e-35
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 2 Region: 537-745,794-882
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.34e-34
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000017255   Gene: ENSCJAG00000009420   Transcript: ENSCJAT00000018250
Sequence length 975
Comment pep:novel chromosome:C_jacchus3.2.1:22:15727987:15787538:1 gene:ENSCJAG00000009420 transcript:ENSCJAT00000018250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHGLSEAELKDVLSLDDEVLQAVYQDWTPPSKELLRFPPLLWVRLRRDLGYCLARRPVDG
STLLAIAHRQLVQVVRERYLSGSERAERHGVLADFFSGTWSQGTKKLITLPLVGKPLNLD
RKVAPQPLWFSDTVANLRKLKELPYHLLHSGRLEELKQEVLAAWGWNSCRISGSIEDPAG
TTFDLCGPSLTLSESLGWSRELQLCRPAVGLSKPWRSLLYTELLARLHFFATSHPALVGQ
LCQQAQSWFRLCAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAMAWGEEEKLLVIGTQD
GIMAVWDMEEQHVIHMLTGHTGEVRCVKVFAKGTLAISASKDYTLRLWNLLSGREKFTIW
DGSSKNLTGPQTWSLHVNEAHKVVYSASGSKINAWNLETAELVFHILGDASDPWMCMAVL
DSQATLLMVSRVGVVSLWNSATGKLQGKQHMSSIKEETPTCAVSVQKQGKLVTGFSNGSI
SLVSSEGDRLLEKLPDAVRFLVVSEDESLLAAGFGRSVRIFLADSWGFHQFMAADLEHED
MVETAVFGTENNLIITGSLDALVQVWSLSEQGTLLDILEGVGGPVSLLASCGALVASASW
QSSSFKVWDLSNAHRPRAPAPFLDRTGLTAVSHNGSYVYFPKIGDKNKVTIWDLAEGEEQ
DSLDTSSEVRCLEVAEQHKLLFTGLVSGVVLVFPLNSRQDVICIPPPEARKAVSCMSLSK
REDRLAIAYDSIVLVLDISPGDPCPLIDGPRYTFYTQLPETISNVAVLTDYRVIYSMTNG
DLFLYECANSKAFPLEAHRSRVTCVEVSHKEQLLASGSEDALLCLWDLQAWKRIFEMTYT
SSYCRGVQCACFSKDDNYVYVGLKDRSILVWSVLDGTLLTVQFVHAVVNRIIPTTSGFIA
PTRHGYLIRERFQCLLARASQQDPHKDFKKAVWMVKSRQREALAAAAGAFQDLESESAQG
NESKSNKCSQVCLIV
Download sequence
Identical sequences F7HW21
ENSCJAP00000017255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]