SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000017281 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000017281
Domain Number 1 Region: 108-183
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000122
Family HLH, helix-loop-helix DNA-binding domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000017281   Gene: ENSCJAG00000009439   Transcript: ENSCJAT00000018278
Sequence length 323
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:21:36982405:36985668:1 gene:ENSCJAG00000009439 transcript:ENSCJAT00000018278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMG
SAGVHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKR
MLDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH
HAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSS
ASLPGSGLSSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGGSGGFQHWGGMPCPCSMCQV
PPPHHHVSAMGAGSLPRLTSDAK
Download sequence
Identical sequences F7IRQ1
XP_003735437.2.60252 ENSCJAP00000017281 ENSCJAP00000017274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]