SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000017852 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000017852
Domain Number 1 Region: 104-184,251-441
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.45e-35
Family G proteins 0.00041
Further Details:      
 
Domain Number 2 Region: 255-283,451-522
Classification Level Classification E-value
Superfamily TrmE connector domain 6.8e-18
Family TrmE connector domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000017852   Gene: ENSCJAG00000009731   Transcript: ENSCJAT00000018878
Sequence length 522
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:16296593:16301083:1 gene:ENSCJAG00000009731 transcript:ENSCJAT00000018878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRGLWTLAAQAARGPRRLCTRRNSGAPVPGSGATIFALSSGQGRCGVAVIRTSGPASGH
ALRILTAPRDLPPARHASLRLLSDPRSGEPLDRALVLWFPGPKSFTGEDCVEFHVHGGPA
VVSGVLRALGSVPGLRPAEAGEFTRRAFAHGKLNLTEVEGLADLIHAETEAQRRQALRQL
DGELGHLCRGWAETLTKALAHVEAYIDFGEDDNLEEGVLEQGGHLGLGRKMPRFTPKCSP
HCLSACLPSPTANIEVRALEVALGAHLRDARRGQRLRSGAHVVVTGPPNAGKSSLVNLLS
RKPVSIVSPEPGTTRDVLETPVDLAGFPVLLSDTAGLREGVGPVEQEGVRRARERLEQAD
LILAMLDASDLASPSSCNFLATVVASAGAQSRSSSSQRLLLVLNKSDLLSTEGPGPGPDM
PPHLLLSCVTGEGLDGLLEALKMELAAVCGDPSTGPPLLTRARHQHHLQGCLDALGHYKQ
SKDLALAAEALRVARGHLTRLTGGGGTEEILDIIFRDFCVGK
Download sequence
Identical sequences F7HKN9
ENSCJAP00000017852 ENSCJAP00000017861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]