SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000017933 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000017933
Domain Number 1 Region: 21-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.88e-90
Family Carbonic anhydrase 0.000000000709
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000017933   Gene: ENSCJAG00000009756   Transcript: ENSCJAT00000018959
Sequence length 337
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:4233949:4240988:1 gene:ENSCJAG00000009756 transcript:ENSCJAT00000018959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDRVTFDPE
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG
SEHQINGEATVAELHVVHYDSESYDSLSEAALRPQGLAVLGILIEVGETKNIAYEHILSH
LHEIRHKDQKTSVPPFNLRELLPPQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISTEQ
LEKLQETLFSTEEEPSEPLVQNYRAPQPLNQRMVFASFIQEGPLYTTGEMLSLGVGILVG
CLCLLLAAYFIARKIRKKRLENRKSVVFTSARATTEA
Download sequence
Identical sequences F7IC13
ENSCJAP00000017933 ENSCJAP00000017933 XP_002759911.1.60252 XP_008982515.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]