SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018110 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018110
Domain Number 1 Region: 1052-1200,1233-1313
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-37
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 1376-1590
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-32
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 3 Region: 128-277,337-406
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-26
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 576-725,765-814
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-25
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018110   Gene: ENSCJAG00000009856   Transcript: ENSCJAT00000019140
Sequence length 1767
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:17:69335570:69430567:-1 gene:ENSCJAG00000009856 transcript:ENSCJAT00000019140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKKSKDQTGEVPQPRPQLDLKVSR
KLPKLYGNIPQDLIGKPLEDLDPFYRDHKTFMVLNKKRTIYRFSAKRALFIFGPFNSIRS
LAIRVSVHSLFSMFIISTVIINCVFMASGLGKTSNSNDTDIAEYVFTGIYIFEALIKILA
RGFILDEFSFLRDPWNWLDSLVIGTAMVSYWCISINLLSLRTFRVLRALKAISVVSRLKV
IVGALLRSVKKLINVIILTLFCLSIFALVGQQLFMGSLNLKCVRSDCKNVSNQEACDYCF
EKKENSTEFRMCGTWMGNSSCSSQYECIHTRINPDYNYTNFDNFGWSFLAMFRLMTQDSW
EKLYQQTLRTTGLYSVFFFIVVIFLGSFYLINLTLAVVTMAYEEQNRNVAAEIEAKEKMF
QEAQQLLREEKEALVAMGIDRSSLTSLETSHFSPQKRKLFGNKKRKSFFMREPGKDQPPG
SDSDEDSQKTPQLLEQTKRLSHNLSLDHFDEHGDPLQRQRALSAVSILTITMKEQEKSQE
PCLPCGENLASKYLVWNCCPQWVAIKKVLRIVMTDPFTELAITICIIINTVFLAMEHHKM
EASFEKMLNTGNLVFTSIFLAEMCLKIIALDPYHYFRRGWNVFDSIVALLSFADVLNGIF
QKRSWPFLRSFRVLRVFKLAKSWPTLNTLIKIIGNSVGALGSLTVVLAIVIFIFSVAGMQ
LFGSSFNSLKSAKLCDPTDPTVSCLRHWHMGDFWHSFLVVFRILCGEWIENMWECMQEAN
TSLCVIVFVLITVIGKLVVLNLFIALLLNSFSNEERNGSVEGEARKTKVQLALDRFHWAF
CFVIHTLEHFFHKWCWKQKSPKQKEVTGGCAAQSKDFIPLVRETKRGSETQEELGIQASV
PKTLGVGHDRTWLAPLAEEEDDVEFSGGDNAQPITQSEAEQQACELHQETKKPISQRVRS
VEIDMLSEDEPHLTVQNPRKKSDATSMLSECSTIDLQDAFGWLPEMVPKKEPERCLPKGL
GCCLPCCNIDKRKSPWVVWWNLRKTCYQIVKHGWFESFIIFVILLSSGALIFEDVHLEGR
PKIQELLNCTDFIFTHIFILEMLLKWVAFGFGKYFTSAWCCLDFIIVIVSVTSLINLKEL
KSFRTLRALRPLRALSQFEGMKVVVNALIGAIPAILNVLLVCLIFWLIFCILGVYFFSGK
FWRCINGTDSVINYTIVPNKNQCESGNFSWLNQKVNFDDVGNAYLALLQVATFKGWMDII
RAAVDSRGKEQQPAFESSSLSYLYFVVFIIFGSFFTLNLFIGVIIDNFNQQQKKLGGQDI
FMTEEQKKYYNAMKKLGSKKPLKPIPRPLNKCQGLVFDIVTSQIFVAESYNQLRATESAL
DRLNWTFVAVFTVECLIKIFALRQHYFTNGWNLFDCVVVVLSIVSTIVSILAKQDHIPFP
PTLFRIVRLARIGRILRLVRAARGIRTLLFALMMSLPSLFNIGLLLFLVMFIYAILGMNW
FSKVNPESGIDDIFNFQTFASSMLCLFQITTSAGWDALLSPMLRSKESCNSSSENCHLPG
IATSYFVSYIIISFLIVVNMYIAVILENFNTATEESEDPLGEDDFDIFYEVWEKFDPEAT
QFIKYSALSDFADALPEPLRVAKPNKYQFLVMDLPMVSGDRLHCLDILFAFTTNVLGGSD
GLDSMKTMMEEKFMEANPFKKLYEPIVTTTKRKEEERCAAVIQKAFRKYMMKATKGDLEN
RPHSSLQTLCNGDLSSSGVAKGKVHCD
Download sequence
Identical sequences F7ESD0
ENSCJAP00000018110 ENSCJAP00000018110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]