SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018127 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000018127
Domain Number - Region: 32-103
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000602
Family Cgl1923-like 0.021
Further Details:      
 
Domain Number - Region: 126-157
Classification Level Classification E-value
Superfamily delta-Endotoxin (insectocide), N-terminal domain 0.0959
Family delta-Endotoxin (insectocide), N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018127   Gene: ENSCJAG00000009786   Transcript: ENSCJAT00000019157
Sequence length 195
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:4241505:4245217:-1 gene:ENSCJAG00000009786 transcript:ENSCJAT00000019157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGRCSALPTTSCLISGLSFGIISG
VFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWAL
GLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSVQRSLLCRRQED
SRVMVYSALRIPPED
Download sequence
Identical sequences F7EDV3
ENSCJAP00000018127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]