SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018130 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000018130
Domain Number - Region: 65-116
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0034
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018130   Gene: ENSCJAG00000009786   Transcript: ENSCJAT00000019159
Sequence length 190
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:4241933:4245215:-1 gene:ENSCJAG00000009786 transcript:ENSCJAT00000019159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGKADEGLASLSEDGRSPISIRQM
AYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVV
FFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLR
SVQRSLLCKD
Download sequence
Identical sequences F7EDG9
ENSCJAP00000018130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]