SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018166 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018166
Domain Number 1 Region: 396-510,630-776
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.85e-62
Family Phosphate binding protein-like 0.00000000254
Further Details:      
 
Domain Number 2 Region: 26-377
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.05e-53
Family L-arabinose binding protein-like 0.0061
Further Details:      
 
Domain Number 3 Region: 526-629
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000334
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018166   Gene: ENSCJAG00000004624   Transcript: ENSCJAT00000019197
Sequence length 895
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:51242147:51610838:1 gene:ENSCJAG00000004624 transcript:ENSCJAT00000019197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WVLLCFLTPVKLHSEVWGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMT
YRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQD
ALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQD
LEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVT
GFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQR
IDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEM
KHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEG
NDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVA
PLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVS
VVLFLVSRFSPYEWHSEELEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLS
GRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKE
FFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKP
CDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKD
SGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSIN
EAIRTSTLPRNSGAGASGGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL
Download sequence
Identical sequences F7D1C2
ENSCJAP00000018166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]