SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018242 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018242
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.79e-38
Family Voltage-gated potassium channels 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018242   Gene: ENSCJAG00000009916   Transcript: ENSCJAT00000019274
Sequence length 769
Comment pep:novel chromosome:C_jacchus3.2.1:4:71315217:71549789:1 gene:ENSCJAG00000009916 transcript:ENSCJAT00000019274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFVMIVVFGLEFIIRIWSAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQG
NIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFL
VYLVEKDANKEFSTYADALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPA
GILGSGFALKVQEQHRQKHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTC
SPTKKEQGEASSSQKLSFKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQK
SWSFNDRTRFRPSLRLKSSQPKPVIDADTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIR
AIRIMKFHVAKRKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGKGQITSD
KKSREKITAEHETTDDLSMLGRVVKVEKQVQSIESKLDCLLDIYQQVLRKGSASALALAS
FQIPPFECEQTSDYQSPVDSKDLSGSGQNSGCLSRSTSANISRGLQFILTPNEFSAQTFY
ALSPTMHSQATQVPMSQSDGSAVAATNTIANQINPAPKPAAPTTLQIPPPLPAIKHLPRP
ETLHPNPAGLQESISDITTCLVASKENVQVAQSNLTKDRSVRKSFDMGGETLLSVCPMVP
KDLGKSLSVQNLIRSTEELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETET
DTFDAAQQPAREAAFASDSLRTGRSRSSQSICKAGESTDALSLPHVKLK
Download sequence
Identical sequences F7GR03
ENSCJAP00000018242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]