SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018307 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018307
Domain Number 1 Region: 372-524,558-623
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000361
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 70-256
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000785
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000018307
Domain Number - Region: 282-336
Classification Level Classification E-value
Superfamily EF-hand 0.0747
Family Calmodulin-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018307   Gene: ENSCJAG00000009898   Transcript: ENSCJAT00000019341
Sequence length 748
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:103629111:103681056:1 gene:ENSCJAG00000009898 transcript:ENSCJAT00000019341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLLLLSLCEAP
AVPALRLGIYVHATLELFALMVVVFELCMKLRWLGLHTFIRHKRTMVKTSVLVVQFVEAI
VVLVRQTSHVRVTRALRCIFLVDCRYCGGVRRNLRQIFQSLPPFMDILLLLLFFMIIFAI
LGFYLFSPDPSDPYFSTLENSIVSLFVLLTTANFPDVMMPSYSRNPWSCVFFIVYLSIEL
YFIMNLLLAVVFDTFNDIEKRKFKSLLLHKRTAIQHAYRLLVSQRRPAGISYRQFEGLMR
FYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNREHWFDELPRTAL
LIFKGINILVKSKAFQYFMYLVVAVNGVWILVETFMLKGGNFFSKHVPWSYLVFLTIYGV
ELFLKVAGLGPVEYLSSGWNLFDFSVTVFAFLGLLALALNMEPFYFIVVLRPLQLLRLFK
LKERYRNVLDTMFELLPRMASLGLTLLIFYYSFAIVGMEFFCGILFPNCCNTSTVADAYR
WRNHTVGNRTVVEEGYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQTSHWSRLYF
MTFYIVTMVVMTIIVAFILEAFVFRMNYSRKNQDSEVDGGITLEKEISKEELVAVLELYR
EARGASSDVTRLLETLSQMERYQQHSMVFLGRRSRTKSDLSLKMYQEEIQEWYEEHAREQ
EQQRQLSSSAASATQQPPGSRQRSQTVT
Download sequence
Identical sequences F7F4J7
ENSCJAP00000018307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]