SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018413 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018413
Domain Number 1 Region: 1150-1305,1344-1423
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-42
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1474-1722
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 130-275,351-420
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-30
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 717-864,896-943
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-29
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018413   Gene: ENSCJAG00000009878   Transcript: ENSCJAT00000019454
Sequence length 1962
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:17:69021138:69107885:-1 gene:ENSCJAG00000009878 transcript:ENSCJAT00000019454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANLLLPRGTSSFRRFTRESLAAIEKRMAEKQARSSAASQESREGLPEEEAPRPQLDLQA
SKKLPDLYGNPPRELIGEPLEDLDPFYSTQKTFIVLNKGKTIFRFSATNALYILSPFHPI
RRAAVKILVHSLFSMLIMCTILTNCVFMAQHDPPPWTKYVEYTFTAIYTFESLVKILARG
FCLHAFTFLRDPWNWLDFSVIVMAYVSENIKLGNLSALRTFRVLRALKTISVIPGLKTIV
GALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTALNGTNGSVEADGSV
WESLDLYLSDPENYLLKNGTSDVLLCGNSSDAGTCPEGYRCLKAGENPDHGYTSFDSFAW
AFLALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQN
QATIAETEEKEKRFQEAMEMLKKEHEALTIRGVDTVSRSSLEMSPLAPVTIHERRSKRRK
RMSSGTEECGEDRLPKSDSEDGPRAVNRLSLTHGLSRTSMKPRSSRGSIFTFRRRDLGSE
TDFADDENSTAGESESHHTSLLVPWPLRRTGAQGQPNIGTAAPGHALNGKKNSTVDCNGV
VSLVGAGDPEATSPGSHLLRPVMLEHPLDTTTPSEEPGGPRMLTPQAPCVDGFEEPEARQ
RALSAVSVLTSALEELEESQRKCPPCWNRFAQRFLIWECCPLWISVKQGVKFVVTDPFAD
LTITMCIVLNTLFMALEHYNMTSEFEDMLQVGNLVFTGIFTAEMTFKIIALDPYYYFQQG
WNIFDSIIVVLSLMELGLSRMSNLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALG
NLTLVLAIIVFIFAVVGMQLFGKNYSELRHSDSGLLPRWHMMDFFHAFLIIFRILCGEWI
ETMWDCMEVSGQSLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLTAPDEDRELNNLQ
LALARIQRGLRFIKWTTWDFCCGLLRQRPQKPAALAAPGQLPSCIATPHSPPPPETEKAP
PARKETRFEEGEQLGQGTPGDPETVCVPIAVAESDTDDQEEDEENSLGPEEESCKQTPED
SYSEGSTADMTNTAELLEQIPDLGQDVKDPEDCFTEGCVRRCPCCAVDTTQAPGKVWWQL
RKTCYRIVEHSWFETFIIFMILLSSGALAFEDIYLEERKTIKVLLEYADKMFTYVFVLEM
LLKWVAYGFKKYFTNAWCWLDFLIVDVSLVSLVANTLGFAEMGPIKSLRTLRALRPLRAL
SRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRCINQTEGDLPLN
YTIVNNKSQCESLNMTGELYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGY
EEQPQWEYNLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKY
YNAMKKLGSKKPQKPIPRPLNKYQGFIFDVVTKQAFDVTIMFLICLNMVTMMVETDDQSP
EKVNILTKINLLFVAIFTGECIFKMAALRHYYFTNSWNIFDFVVVILSIVGTVLSDIIQK
YFFSPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIF
GMANFAYVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPNLPN
SNGSRGDCGSPAVGILFFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMF
YETWEKFDPEATQFIEYSALSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDIL
FAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSATVIQRAFRR
HLLQRSMKHASFLFRQQAGSGLSEEDAPEREGLIAYMMNENFSRPPGLPSSSSISSTSFP
PSYDSVTRATSDNLQVRGSDDSHSEDLADFPPSLDRDRESIV
Download sequence
Identical sequences F7H669
ENSCJAP00000018413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]