SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018454 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018454
Domain Number 1 Region: 99-173
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.29e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018454   Gene: ENSCJAG00000010053   Transcript: ENSCJAT00000019499
Sequence length 227
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:57016603:57093166:-1 gene:ENSCJAG00000010053 transcript:ENSCJAT00000019499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELKSLSGEAYLALSQGYSAAAAGLAYGAARGPNSARGYGALGPGGDLPAVPAPRAPAP
AAESSGEQSGDEDDAFEQRRRRRGPGGAGDARRRPREQRSLRLSINARERRRMHDLNDAL
DGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALDEMRRLVAFLNRGQGLAAPVST
AAPLTPFGQAAVCPFSAGGAALGPCPDKCAAFSGTPSALCKHCTEKP
Download sequence
Identical sequences F7GQN9
ENSCJAP00000018454 XP_017828595.1.60252 ENSCJAP00000018454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]