SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018471 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018471
Domain Number 1 Region: 1467-1718
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-36
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1143-1298,1338-1417
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-29
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 3 Region: 129-271,334-403
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.77e-28
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number 4 Region: 657-886
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-28
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018471   Gene: ENSCJAG00000031394   Transcript: ENSCJAT00000019516
Sequence length 1948
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:17:69172677:69283669:-1 gene:ENSCJAG00000031394 transcript:ENSCJAT00000019516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPIGSLETNNFRRFTPESLVEIEKQIAAQQAAKKTREKHREQKDQEEKLRPQLDLKAC
NQLPKFYGELPAELIGEPLEDLDTFYSTHRTFMVLNKGRTISRFSATRALWLFSPFNLIR
RTAIKVSTHLWFSLFITVTILVNCVCMTQTELPEKIEYVFTAIYTFEASIKILARGFCLN
EFTYLRDPWNWLDFSVITLAYVGTAIDLRGISGLRTFRVLRALKTVSVIPGLKVIVGALI
HSVKKLADVTILTIFCLSVFALVGLQLFKGNLKNKCVKNAMAVNETTNYSSHGKYIFINK
RGTSDPLLCGNGSDSGHCPDGYICLKTFDNPDFNYTSFDSFAWAFLSLFRLMTQDSWERL
YQQTLRASGKIYMIFFVLVIFLGSFYLVNLILAVVTMAYEEQNQATIDEIEAKEKKFQET
LEMLRKEQEVLAALGIDTTSLHSHNGSPLTSKNASERRHRIKPRVSEGSTEGNKSPHSDP
YNQRRMSFLGLASGRRRASHGSVFHFRFPGRDISLPEGVTDDGAFPGDRESYRGSLLLGG
GAGQQGPLPRSPQPSNPDSMHGEDEHPPLAPGAVEVSAFDAGQKKTFLSAEYLDEPFRAQ
RAMSVVSIITSVLEELEESEQRCPPCLTSLAQKYLIWDCCPTWLKLKTILFGLVTDPFAE
LTITLCIVVNTVFMAMEYHGMSSTFEAMLYIGNIVFTVVFTAEMVFKIIAFDPYYYFQKK
WNIFDCIIVTVSLLELGVARKGSLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALG
NLTIILAIIVFVFALVGKQLLGENYRSKRKTISAPHEEWPRWHMCDFFHSFLIVFRILCG
EWIENMWACMEVGQKSICLVLFLTVMVLGNLVVLNLFIALLLNSFSADNLTASEDDGEVN
NLQVALARIQVFGRQTKQALCNFFSRPCPLPWLKAEPELVVKLPLSSSKAENHIAANAAG
GSSGRLPAPRGPRDEHSDFVANPTVWVSVPIAEGESDLDDLEDDGEEYARCSQQEVIPEG
QQELLQQVERCEDLLTPRSPRSGTSSEDLAPYLGETWRNKAVPQAPAEGVDDTSSSEGST
VDCPDPEEILRKIPELADDLEEPEDCFTEGCIRRCPCCKVDATSSPWDVGWQVRKTCYRI
VEHSWFESFIIFMILLSSGSLAFEDYYLDQKPTVKALLEYTDRVFPFIFVFEMLLKWVAY
GFKKYFTNAWCWLDFLIVNVSGSVGTCGCKRSSETWPPSWATTKKSFEHLSAESFSVSHQ
VVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFWRCINYTDGEFSLVPLSIVNN
KTECEIQNSTRSFFWVNVKVNFDNVAMGYLALLQVATFKGWMDIMYAAVDSREVNMQPKW
EDNVYMYLYFVIFIIFGGFFTLNLFVGVIIDNFNQQKKKIRGQDIFMTEEQKKYYNAMKK
LGSKKPQKPIPRPLNKFQGFVFDIVTRQAFDVTIMVLICLNMITMMVETDEQSEEKTKIL
GKINQFFVAVFTGECVMKMFALRQYYFTNGWNVFDFIVVVLSIASLIFSAILKSLQSYFS
PTLFRVIRLARIGRILRLIRAAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMTS
FPHVRWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPNLPNSNGS
RGDCGSPAVGILFFTTYIIISFLIVVNMYIAVILENFNVATEESTEPLSEDDFDMFYETW
EKFDPEATQFITFSALSDFADTLSGPLRIPKPNRNILSQMDLPLVPGDKIHCLDILFAFT
KNVLGESGELDSLKANMEEKFMATNLSTSSYEPIATTLRWKQEDLSATVIQKAYRSYVRH
RSMALSNTPHVPRAEEETASLPGEGFVAFMANENCVLPDKSETASATSFPPSYESVTRGL
SDRVNMSTSSSIQNEDKATSKEVTAPGP
Download sequence
Identical sequences F7G8Q8
ENSCJAP00000018471 ENSCJAP00000018471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]