SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018548 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018548
Domain Number 1 Region: 52-270
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.97e-88
Family Calnexin/calreticulin 0.00000000288
Further Details:      
 
Domain Number 2 Region: 261-401
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.31e-58
Family P-domain of calnexin/calreticulin 0.0000000338
Further Details:      
 
Domain Number 3 Region: 404-448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000918
Family Calnexin/calreticulin 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018548   Gene: ENSCJAG00000009989   Transcript: ENSCJAT00000019597
Sequence length 584
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:59322662:59346219:1 gene:ENSCJAG00000009989 transcript:ENSCJAT00000019597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLVLGTAVVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPPSPKVTYKAPVPTGE
VYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKESKLPGDKGLVLMSRAKH
HAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTSDLNLDQFHDKTPYTIM
FGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSF
EILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDA
PAKIPDDEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGV
WQRPMIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWS
MTSDIFFDNFIICADRRVVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYI
LTVALPVFLVILFCCSGKKQTSAMEYKKTDAPQPDVKKLVVDLEMCSNANCQQNRLTSVL
EEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
Download sequence
Identical sequences F7EBW0
ENSCJAP00000018548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]