SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018619 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018619
Domain Number 1 Region: 87-199
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 1.7e-25
Family Ribosome-binding factor A, RbfA 0.00000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018619   Gene: ENSCJAG00000010125   Transcript: ENSCJAT00000019668
Sequence length 343
Comment pep:novel chromosome:C_jacchus3.2.1:13:117581346:117596166:1 gene:ENSCJAG00000010125 transcript:ENSCJAT00000019668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAAAGGLWGSRAGLRVLLRSRDAALVPDCARGLHGSTVSCKNWLKKFASKTKKKFWYEG
PSLGSHLTYKPSKLEFLMRSTSQKTRKEDHVRLRALNGLLYKALTDLLCTPEVSQELYDL
NVELSKVSLTPDFSACRVYWKTTLSAEQNVRTETVLQKSAAHMRHLLMSQQTLRNVPPIV
FVKDKQSAALAEIDQLLAVADFGPPDQRDDFVRNDFRNLDAPRPCGTTEPATSSSLCGID
HEALNKQIMEYKRRKDKGLGGLVWQGQVAELTAQMKKGRKKAKRVLEQDSSLKSYLSGEE
GEDDLDLDGTLEYECSAPDTEELEAERRGSITEDDRSCRARGE
Download sequence
Identical sequences F7H5Z7
ENSCJAP00000018619 ENSCJAP00000018619 XP_002757407.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]