SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018652 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018652
Domain Number 1 Region: 2-369
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.33e-43
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 
Domain Number 2 Region: 1504-1578,1630-1775,1835-1903
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.74e-42
Family WD40-repeat 0.0085
Further Details:      
 
Domain Number 3 Region: 614-960
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.86e-42
Family WD40-repeat 0.0016
Further Details:      
 
Domain Number 4 Region: 657-750,933-1085,1160-1204,1386-1470
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.37e-40
Family Quinoprotein alcohol dehydrogenase-like 0.042
Further Details:      
 
Domain Number 5 Region: 1116-1200,1335-1368
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000769
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 6 Region: 454-528
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000011
Family WD40-repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018652   Gene: ENSCJAG00000010107   Transcript: ENSCJAT00000019703
Sequence length 1913
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:52525048:52803399:-1 gene:ENSCJAG00000010107 transcript:ENSCJAT00000019703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALHPDKTLVATGQVGKEPYICVWDSYNVQTVSILKDVHTHGVACLAFDSDGQRLASVGL
DAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFWTLCGNALTA
KRGIFGKTGDLQTILCLACAKEDITYSGALNGDIYVWKGLNLVRTIQGAHSAGIFSMYVC
EEGFATGGRDGCIRLWDTDFKSITKIDLRETEQGYKGLSIRSVCWKADRLLAGTQDSEIF
EVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCNME
EAVRSVAFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLAVG
SNDGPVDVYAVAQRYKKIGECNRSLSFITHIDWSLDSKYLQTNDGAGERLFYKMPSGKPL
TSKEEIKGIPWASWTCVKGPEVSGIWPKYTEVTDVNSVDANYNSSVLVSGDDFGLVKLFK
FPCLKRGARFRKYVGHSAHVTNVRWSHDFQWVLSTGGADHSVFQWRFIPEGVSNGMLETA
PQEGGTDSYSEESDSDLSDVPELDSDIEQETQINYDRQVYKEDLPQLKQQSKEKNHVVPF
LKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHSQRLYLGH
DDDILSLTIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVCALDFSADGKC
LVSVGLDDFHSIVFWDWRKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGIKHIKFWQQA
GGGFTSKRGTFGSVGKLETMMCVSYGRMEDLVFSGAATGDIFIWKDVLLLKTVKAHDGPV
FAMYALDKGFVTGGKDGIVELWDDMFERCLKTYAIKRSALSTSSKGLLLEDNPSIRAITL
GHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWE
LSAQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMVSFHHRKEMIS
DIKFSKETGKYLAVASHDNFVDIYNVLTSKRIGICKGASSYITHIDWDSRGKLLQVNSGA
KEQLFFEAPRGKRHVIRPSEIEKIEWDTWTCVLGPTCEGIWPAHSDITDVNAASLTKDCS
LLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALMIW
TREFVGTQESKLVDSEESDTDVEEDGGYDSDVAREKAIDYTTKIYAVSIREMEGTKPHQQ
LKEVSVEERPPVSRAAPQPEKLQKNNITKKKKLVEELALDHVFGYRGFDCRNNLHYLNDG
ADIIFHTAAAGIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIALLLCHTSP
CSGTTPSIHIWDAMTKHTLSMLRCFHSKGVNYVNFSATGKLLVSVGVDPEHTITVWRWQE
GAKVASRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSALLYKKGVIGSLGAAKM
QTMLSVAFGANNLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGK
ERPTKEGGAVKLWDQEMKRCRAFQLETGQLVECVRSVCRGKGKILVGTKDGEIIEVGEKN
AASNILIDGHMEGEIWGLATHPSKDLFISASNDGTARIWDLADKKLLNKVSLGHAARCAA
YSPDGEMVAIGMKNGEFVVLLVNSLKVWGKKRDRKSAIQDIRISPDNRFLAVGSSEHTVD
FYDLTQGTNLNRIGYCKDIPSFVIQMDFSADGKYIQVSTGAYKRQVHEVPLGKQVTEAMV
IEKITWASWTRNSVLGDEVIGIWPRNADKADVNCACVTHAGLNIVTGDDFGLVKLFDFPC
TEKFAKHKRYFGHSAHVTNIRFSYDDKYVVSTGGDDCSVFVWRCLLITIHTNH
Download sequence
Identical sequences F7GQJ1
ENSCJAP00000018652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]