SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018857 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018857
Domain Number 1 Region: 296-396
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.49e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 29-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.16e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 113-167,195-214
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.4e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018857   Gene: ENSCJAG00000010162   Transcript: ENSCJAT00000019917
Sequence length 582
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:76891717:77005307:1 gene:ENSCJAG00000010162 transcript:ENSCJAT00000019917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCN
AMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVG
CDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAK
TGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKDRKSFCTIHS
TGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRH
AIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCY
KFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMD
SMLPSGESGPKRSHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNI
TSTPPPDASSPGGKKILNGGTPDIPSSGLLPGQAQENPGYPYSDSSSILGENPHIGIDMI
DNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences F7HG80
ENSCJAP00000018857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]