SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019066 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000019066
Domain Number - Region: 50-96
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.0432
Family 2-methylcitrate dehydratase PrpD 0.1
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019066   Gene: ENSCJAG00000010348   Transcript: ENSCJAT00000020139
Sequence length 257
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:76375465:76379688:-1 gene:ENSCJAG00000010348 transcript:ENSCJAT00000020139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKIGSRRWMLQLIMRLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMG
AAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRMYSRTVAIIGGF
LVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMI
QLFFVLYGVLALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVAYWHNTRRVEFWNQMKLL
GESVGIFGTAVILATDG
Download sequence
Identical sequences F6T710
XP_002748089.2.60252 ENSCJAP00000019066 ENSCJAP00000019066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]