SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019243 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019243
Domain Number 1 Region: 9-126
Classification Level Classification E-value
Superfamily POZ domain 1.26e-30
Family BTB/POZ domain 0.00046
Further Details:      
 
Domain Number 2 Region: 432-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019243   Gene: ENSCJAG00000010439   Transcript: ENSCJAT00000020327
Sequence length 591
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:57755412:57814256:-1 gene:ENSCJAG00000010439 transcript:ENSCJAT00000020327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDRKEDMEIASHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLLGSSRYFKTLY
CQVQKTSEQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQA
CHDFIKAALDISIKSDASDELAEFEIGASSSSSTEALISAVMAGRSISPWLARRTSPANS
SGDSAIASCHDGGSSYGKEDQEPKADGPDNVSSQSLWPGDVGYGPLRIKEEQISPPQYGG
SELPSAKDSVVQNSFSEQSAGDGWQPTGRRKNRKNKETVRHITQQVEDDSRTSSPVPSFL
ATSGWPLSSRDSTVGKIVSLSAAVHVEGVQAAEHVHISQGKVVLSGEWAWMGPSLPLWPS
QEEALTSVWIISNFSTSVTNSRLSLKTKKKGKNTGFLYRGWPQGTHHGDVNEFTVIRKKF
KCPYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKV
CSRVFMSAASVGIRHGSRRHGVCADCAGQGMAGPLDHGGGGGEGSPEALFPADGPYLEDP
DDPRGEVEELGEDDEGLAPEDALLADDKDDEDSPQPRSPPGGPDKDFAWLS
Download sequence
Identical sequences F6TRK5
ENSCJAP00000019243 ENSCJAP00000019243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]