SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019256 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019256
Domain Number 1 Region: 62-333
Classification Level Classification E-value
Superfamily Radical SAM enzymes 3.4e-74
Family MoCo biosynthesis proteins 0.0000051
Further Details:      
 
Domain Number 2 Region: 489-633
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis protein C, MoaC 2.35e-52
Family Molybdenum cofactor biosynthesis protein C, MoaC 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019256   Gene: ENSCJAG00000010427   Transcript: ENSCJAT00000020340
Sequence length 636
Comment pep:novel chromosome:C_jacchus3.2.1:4:41004168:41036520:-1 gene:ENSCJAG00000010427 transcript:ENSCJAT00000020340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARPLSRMLQRLLGSSSRSCSSGAPVRQPRPRESAQAASEELSKQRQFLRGHAAPFSAI
LTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGVQLTPKANLLTTEEILTLARLFVKEGVD
KIRLTGGEPLIRPDVVDIVAQLQQLEGLRTIGVTTNGINLARLLPQLQKVGLSAINISLD
TLVPAKFEFIVRRKGFHKVMDGIHKAIELGYNPVKVNCVVMRGLNEDELLDFAALTKSLP
LDVRFIEYMPFDGNKWNFKKMVSYKEMLDTVRQQWPELEKLPEEESSTAKAFRIPGFQGQ
ISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRIIGAAVG
RKKRQHAGMFSISQMKNRPMILIELFLMFRDSPPANPSISSWDALHVEGLRSRMSFSSQM
ATLWKGYRVPQTPPLAEQQLGSGSFQRHYTSHADSDANSQCLSPDSWASAAPSGPQLTSE
QLTHVDSEGRATMVDVGGKPDTERVAVASAVVLLGPVAFKLVQQNQLKKGDALVVAQLAG
VQAAKLTSQLIPLCHHVALSHVQVQLELDSTRHAVEIRASCRARGPTGVEMEALTSAAVA
ALTLYDMCKAVSRDIVLEEIKLISKTGGQRGDFHRA
Download sequence
Identical sequences F6TFJ7
XP_002746562.2.60252 ENSCJAP00000045342 ENSCJAP00000019256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]