SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019401 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000019401
Domain Number - Region: 248-343
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.00065
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019401   Gene: ENSCJAG00000010505   Transcript: ENSCJAT00000020493
Sequence length 523
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:116513327:116618905:-1 gene:ENSCJAG00000010505 transcript:ENSCJAT00000020493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLSFTFD
CNFKTKMIRVCVRVCMKNKRPGPYAQQCQALVVYIIVRKYKSMILEDLESALAEHAPAPQ
EVNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIP
WANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATATHSIAH
LVPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQN
WATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLA
EATLQGGGQIVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTDKATGLVQIPVSMYQ
TVVTSLAQGNGPVQVAMAPVTTRISDSAVTMDGQAVEVVTLEQ
Download sequence
Identical sequences F6PHI4
ENSCJAP00000019401 ENSCJAP00000019400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]