SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019416 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019416
Domain Number 1 Region: 7-97
Classification Level Classification E-value
Superfamily ApaG-like 7.19e-31
Family ApaG-like 0.00041
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000019416
Domain Number - Region: 105-138
Classification Level Classification E-value
Superfamily ARM repeat 0.00489
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019416   Gene: ENSCJAG00000010459   Transcript: ENSCJAT00000020509
Sequence length 158
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:96956060:96967605:-1 gene:ENSCJAG00000010459 transcript:ENSCJAT00000020509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRVYEYTSCTTFSTTS
GYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEYEEMEEEEEEEEEE
DEDDDSADMDESDEEDEEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences F6U1B5
ENSCJAP00000019416 ENSCJAP00000049837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]