SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019421 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019421
Domain Number 1 Region: 195-269
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0000749
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000019421
Domain Number - Region: 260-300
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0142
Family Leucine zipper domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019421   Gene: ENSCJAG00000010451   Transcript: ENSCJAT00000020515
Sequence length 313
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:29169534:29178789:1 gene:ENSCJAG00000010451 transcript:ENSCJAT00000020515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQ
GDTAGAVSVVSTAAFAGGQQAVTQVGVDGAAQRPGPAAASVPPGPAAPFPLAVIQNPFSN
GGSPAAEAVSGEARFAYFPASGVGDTTAVSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQR
TIAPRTHPYSPKIDGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCNADNSKT
GASKGGILSKAGYIRELRQTNQRMQETFKEAERLQMDNELLRQQIEELKNENALLRAQLQ
QHNLEMVGESTRQ
Download sequence
Identical sequences F6U0N8
ENSCJAP00000019421 ENSCJAP00000019421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]