SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019483 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019483
Domain Number 1 Region: 172-334
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.16e-27
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000019483
Domain Number - Region: 349-468
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00217
Family Potassium channel NAD-binding domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019483   Gene: ENSCJAG00000010526   Transcript: ENSCJAT00000020585
Sequence length 1188
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:179859673:179911156:1 gene:ENSCJAG00000010526 transcript:ENSCJAT00000020585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLPVEDFSLDSSLSQVQVEFYVNENTFKERLKLFFIKNQRSSLRIRLFNFSLKLLTCLLY
IVRVLLEDPALGIGCWGCPKQNYTFNDSTSEINWAPILWVERKMTLWVIQHPTLPHPLPS
PHPLSFPHTSQPYPLTSRGNIWEQIFRVSFVLEMINTLPFIITIFWPPLRNLFIPVFLNC
WLAKHALENMINDFHRAILRTQSAMFNQVLILFCTLLCLVFTGTCGIQHLERAGENLSLL
TSFYFCIVTFSTVGYGDVTPKIWPSQLLVVIMICVALVVLPLQFEELVYLWMERQKSGGN
YSRHRAQTEKHVVLCVSSLKIDLLMDFLNEFYAHPRLQDYYVVILCPTEMDVQVRRVLQI
PLWSQRVIYLQGSALKDQDLMRAKMDNGEACFILSSRNEVDRTAADHQTILRAWAVKDFA
PNCPLYVQILKPENKFHVKFADHVVCEEECKYAMLALNCICPATSTLITLLVHTSRGQEG
QESPEQWQRMYGRCSGNEVYHIRMGDSKFFREYEGKSFTYAAFHAHKKYGVCLIGLKRED
NKSILLNPGPRHILAASDTCFYINITKEENSAFIFKQEEKRKKRAFSGQGLHEGPARLPV
HSIIASMGTVAMDLQGTEHRPTQSVGGGGGSKLALPTENGSGSRRPSIAPVLELADSSAL
LPCDLLSDQSEDEVTPSDDEGLSVVEYVKGYPPNSPYIGSSPTLCHLLPVKAPFCCLRLD
KGCKHNSYEDAKAYGFKNKLIIVSAETAGNGLYNFIVPLRAYYRSRKELNPIVLLLDNKP
DHHFLEAICCFPMVYYMEGSVDNLDSLLQCGIIYADNLVVVDKESTMSAEEDYMADAKTI
VNVQTMFRLFPSLSITTELTHPSNMRFMQFRAKDSYSLALSKLEKRERENGSNLAFMFRL
PFAAGRVFSISMLDTLLYQQSFVKDYMITITRLLLGLDTTPGSGYLCAMKITEGDLWIRT
YGRLFQKLCSSSAEIPIGIYRTESHVFSTSESQISVNMEDCEDTREVKGPWGARAGTGGS
SHSRHTGGGDPAEHPLLRRKSLQWARRLSRRGPKQVGRAAAAEWISQQRLSLYRRSERQE
LSELVKNRMKHLGLPTTGYEXVAYLTARDVMNRVNLGYLQDEMNDHQNTLSYVLINPPPD
TRLEPNDIVYLIRSDPLAHVASSSQSRKSSCSHKLSSCNPETRDETQL
Download sequence
Identical sequences F6SRX3
ENSCJAP00000015632 ENSCJAP00000019483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]