SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019584 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019584
Domain Number 1 Region: 1456-1595
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.49e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000221
Further Details:      
 
Domain Number 2 Region: 233-337
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000062
Family Calponin-homology domain, CH-domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019584   Gene: ENSCJAG00000010583   Transcript: ENSCJAT00000020701
Sequence length 1600
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:179927892:180089874:-1 gene:ENSCJAG00000010583 transcript:ENSCJAT00000020701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGRASLKGRRTEKMEAPPDGAADLVPLDRYDAARAKIAANLQWICAKAYGRDNIPEDLRD
PFYVDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQVAALQGHQSVIQALSRKGIYVM
ESDDTPVTESDLSRAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKELP
YDLEDAMVFWINKVNLKMREITEKEVKLKQQLLESPAHQKVRYRREHLSARQSPYFPLLE
DLMRDGSDGAALLAVIHYYCPEQMKLDDICLKEVTSMADSLYNIRLLREFSNEYLNKCFY
LTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDVQELKDAKTVLHQKSSRPPV
PISNATKRSFLGSPASGTPADLQPPTQPLAEGCHRHYLHPEEPEYLGKGTAAFSPSHPLL
PLRQKQQKSMQGEDTPDQRHRSNSLTRVDGQPRGAAIAWPEKKTRPASQPTPFALHHTTS
CEVDPSSGDSVSLARSISKDSLASNIVNLTPQNQPHPTATKTHGKSLLNNVSIEDEEEEL
VAIVRADVAPQRADPEFPRASPRASGLTASAQSPQGQLDTLESKPDSFFLEPLMPAVLKP
AKEKQVITKDDERGEGRPRSIASRRPSEGPQPLVRRKATGSRDLNRTFTPIPCSEFPMGI
DPTETGLQSLETAGEVCGGPLALGRFNQFPQGPSTDGFFLHVGRADEDSEGRLCVSCSKS
PNSHDSEPWTLLRQDSDSDVVDLEEAEHDFMGEAHPVVLSKYIGEEESAKLQEDMKVKEH
EDKDDASGRSSPCLSTASQMSSVSVASGSVKMTSFAERKLQRLNSCETKSSTSSSQKTTP
DASESCPAPLTTWRQKREQSPSRHGRDPASLLASELVQLHMQLEEKRRAIEAQKKKMEAL
SARQRLKLGKAAFLHVVKKGKAEAAPPLRPDHFTKEYSQHNGEECEDGLSKTEDFLVKEE
QREELLHETQDVDKESLAFAQQHKAKDPVALHELERNKVISAALLEDTVGEVVDVNECDL
SIEKLNETISTLQQAILKISQQQEQLLMKSPTVPVPGSKNNSQDHKVKAPVHFVEPLSPT
GVAGHRKAPRLGQGRNSRSGRPAELKVPKDRPQGSSRSKTPTPSVETLPHLRPFPASSHP
RTPTDSSLEGAPEPSSDPHGKCLFDSYRLHDENNQRTLTLSSSKDANILSEQMSLKEVLD
ASVKETGPGSSDISGKESIPVEEPLRSRASLIEVDLSDLKAPDEDGELASLDGSADLTSE
GDQKPGVGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEARVRKQQLEAEVELKRDEARRK
AEEDRVRKEEEKARRELIKQEYLRRKQQQILEEQGLGKPKSKPKKPRPKSVHREESCSDS
GTKCSSTPDNLSRTQSGSSLSLASAATTEPESVHSGGTPSQRVESMEALPILSRNPSRST
DRDWETASAASSLASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILE
ELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKNITKKMIDKLYKYSSDR
KQFNLIPAKTMSVSVDALTIHNHLWQPKRPAVPKKAQTRK
Download sequence
Identical sequences F6QBK6
ENSCJAP00000019584 ENSCJAP00000019579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]