SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019692 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019692
Domain Number 1 Region: 405-579,612-708
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 4.32e-56
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00061
Further Details:      
 
Domain Number 2 Region: 1079-1135
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 4.97e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0001
Further Details:      
 
Domain Number 3 Region: 708-751
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000118
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019692   Gene: ENSCJAG00000010678   Transcript: ENSCJAT00000020812
Sequence length 1135
Comment pep:novel chromosome:C_jacchus3.2.1:14:59078736:59184829:-1 gene:ENSCJAG00000010678 transcript:ENSCJAT00000020812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSTNPGNWVTFDDDPAFQSSQKSKNFPLENQGVCRPNGLKLNLPGLREFPSGSSSTSST
PLSSPIVDLYFSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYPIPESSSDSPLTIPGGG
SSLLPPRPTCLSHALLPSDHSCTHPAPKVGLPDEINSHQAESLEFQSDDLTQFQYFREDC
AFSSPFWKDEGSDSQFTLDPPGSKKMFSSRDREMPIDQKSLNKCSLNYICEKLEHLQSAE
NQDSLRSLSMHCLYAEENASAFVPHTLFRSQPKAGWAFMLRIPEKKNMMSSRQWGPIFLK
VLPGGVLQMYYEQGLEKPFKEIQLDPHCRLSEPKVENFSVAGKIHTVKIEHVSYTEKRKY
HSKTEVVHEPDIEQMLKLGSTSYHDFLDFLTTVEEELIKLPAVSKPKKNYEEQEISLEIV
DNFWGKVTKEGKLVESAVITQIYCLCFVNGNLECFLTLNDTELLKRDESYFEKDTEKRGI
DILDYHLHKCVKVQEFEQSRIIKFVSLDACRFELLRFKTLYNGDDLPFFLKSVVVVQGAY
VELQAFVNMAALVQRSSHAGSLRSCDNIMIHFPVPSQWIKALWTMNLQRQKSLKAKMNRR
ACLGSLHELESEPVIQVTVGSAKYESAYQAVVWKIDRLPDKNSSLDHPHCLSYKLELGSD
QEIPSDWYPFATVQFSMPDTCASRTEVRSLGVESDVQPQNHVQQRACYNIQPKLYRSVIE
DVIERVRNLFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNSIQSPLFTLQLPHNLHQ
TLQSSAGHLYKVNVPIMVTQTSGRGGILQHPSQEVFQQLGQPSVIQTSVLQLNPCSLQAT
TEKSQRIETVLQQPTVLPSGPVDRKHFENTTTDTLVSPGNEHKIMPEVLMSRQESSHYVS
LPSVVFSPQVSQTNSNVESVLSGSASMTQNLHGGSLSMSSHGVLHQHRTDSHPHILKNRM
YGCDSVKQPRNIQEPSNIPVSKKDSNFQVDLNIQVTDDDINEIIQVDGIGDTSSNEEIGN
ARDVDENEFLGIIDTGDLKVLEEEADSISNEDSAATSSDNEDPQVDIVEEDPLNSGDDVS
EQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRDYVFSKAIGDAEW
Download sequence
Identical sequences F6SFM4
ENSCJAP00000019692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]