SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019759 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019759
Domain Number 1 Region: 422-478
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.62e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0001
Further Details:      
 
Domain Number 2 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000068
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019759   Gene: ENSCJAG00000010678   Transcript: ENSCJAT00000020885
Sequence length 478
Comment pep:known chromosome:C_jacchus3.2.1:14:59078670:59147217:-1 gene:ENSCJAG00000010678 transcript:ENSCJAT00000020885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYFNPVPKLYRSVIEDVIERVRNLFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNS
IQSPLFTLQLPHNLHQTLQSSAASLVIPAGRTLPSFTTAELGTSNSSANFTFPGYSIHVP
AGVTLQTASGHLYKVNVPIMVTQTSGRGGILQHPSQEVFQQLGQPSVIQTSVLQLNPCSL
QATTEKSQRIETVLQQPTVLPSGPVDRKHFENTTTDTLVSPGNEHKIMPEVLMSRQESSH
YVSLPSVVFSPQVSQTNSNVESVLSGSASMTQNLHGGSLSMSSHGVLHQHRTDSHPHILK
NRMYGCDSVKQPRNIQEPSNIPVSKKDSNFQVDLNIQVTDDDINEIIQVDGIGDTSSNEE
IGNARDVDENEFLGIIDTGDLKVLEEEADSISNEDSAATSSDNEDPQVDIVEEDPLNSGD
DVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRDYVFSKAIGDAEW
Download sequence
Identical sequences F6WXK5
NP_001191770.1.60252 ENSCJAP00000019759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]