SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019794 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019794
Domain Number 1 Region: 69-103
Classification Level Classification E-value
Superfamily LysM domain 0.0000876
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019794   Gene: ENSCJAG00000010739   Transcript: ENSCJAT00000020920
Sequence length 306
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:117400489:117414449:1 gene:ENSCJAG00000010739 transcript:ENSCJAT00000020920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDMLEEDAEVYELRSRGKEKFRRSTSRDRLD
DIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTET
LCPPKGRQTSHHSSVQYSSEQQELLPANDSLSYSDSAGSFLKEVDRDIEQIVKCTDNKRE
NLNEVVSALTAQQIRFEPDNKNTQHKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYY
EILAKVDVSHHSTVDSSHLHSKITPPSQQREMENGIAPTKGIHFGQQDDHKLYSQDSQSP
AAQRET
Download sequence
Identical sequences F6WD16
ENSCJAP00000019794 XP_008990053.1.60252 ENSCJAP00000019794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]