SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019885 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000019885
Domain Number - Region: 41-86
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0418
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019885   Gene: ENSCJAG00000010704   Transcript: ENSCJAT00000021013
Sequence length 125
Comment pep:known_by_projection scaffold:C_jacchus3.2.1:GL284745.1:88844:99345:1 gene:ENSCJAG00000010704 transcript:ENSCJAT00000021013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPLLISEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVI
IKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQ
KTYAF
Download sequence
Identical sequences H9KWP9
ENSCJAP00000019885 ENSCJAP00000019885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]