SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020236 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020236
Domain Number 1 Region: 295-596
Classification Level Classification E-value
Superfamily Kelch motif 1.06e-49
Family Kelch motif 0.0024
Further Details:      
 
Domain Number 2 Region: 32-147
Classification Level Classification E-value
Superfamily POZ domain 1.84e-30
Family BTB/POZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020236   Gene: ENSCJAG00000009921   Transcript: ENSCJAT00000021379
Sequence length 612
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:3541037:3566019:-1 gene:ENSCJAG00000009921 transcript:ENSCJAT00000021379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELAMDNSYAFNQRSTCNGIPSEKKNNFLISEDHGQKVLSILQNFREQNVFYDFKIIMKD
EIIPCHRCVLAACSDFFRAMFEVNMKERDDGSVTITNLSSKAVKAFLDYAYTGKTKITDD
NVEMFFQLSSFLQVSFLSKACSDFLIKSINLVNCLQLLSLSDSYGSTSLFDHALHFVQHH
FSLLFKSSDFLEMNFGVLQRCLESDELNVPEEEMVLKVVLSWTKHNLESRQKYLPHLIKK
VRLHQLSEETLQDCLFNEESLLKSTNCFDIIMDAIKCVQGSGGLFPDARPSTTEKYIFIH
KTEENGENQYTFCYNIKTDSWKILPQSHLIDLPGSSLSSYGEKIFLTGGCKGKCCRTVRL
HIGESYHDATDQTWCYCPVKNDFFLVSTMKTPRTMHTSVMALDRLYVIGGKTRGARDIKS
LLDVESYNPLSKEWTSVSPLPRGIYYPEASACQNVIYVLGSEVEITDAFNPSLDCFFKYN
ATTDQWSELVAEFGQFFHATLIKAVPVNCTLYICDLSTYKVYSFCPDTCVWKGEGSFECA
GFNAGAIGIEDKIYILGGDYAPDEITDEVQVYHSNRSEWEEVSPMPRALTEFYCQVIQFN
KYRDPWFPTLCA
Download sequence
Identical sequences F7ET45
XP_002754406.1.60252 XP_017833001.1.60252 ENSCJAP00000018217 ENSCJAP00000018217 ENSCJAP00000020236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]