SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020355 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020355
Domain Number 1 Region: 15-67
Classification Level Classification E-value
Superfamily Ribosomal protein L20 0.0000000000146
Family Ribosomal protein L20 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020355   Gene: ENSCJAG00000037565   Transcript: ENSCJAT00000021505
Sequence length 145
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:35905795:35914242:-1 gene:ENSCJAG00000037565 transcript:ENSCJAT00000021505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFLTAQLWLRNRVTDRYWRIQEVLKHARHFRGRKNRCYRLAVRAVTRAFVKCTKARFLK
KRIMRTVSPEPSPARALAAPASLAREPAGVQPLGHPRLLLRFFIPRFETTNSAPADCGTS
VLPPPRHPHCHPLLQPLTRAAASPA
Download sequence
Identical sequences F7GRF1
ENSCJAP00000020355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]