SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020421 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020421
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily PHP domain-like 8.24e-22
Family RNase P subunit p30 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020421   Gene: ENSCJAG00000011045   Transcript: ENSCJAT00000021576
Sequence length 180
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:77685633:77694898:1 gene:ENSCJAG00000011045 transcript:ENSCJAT00000021576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIDRGLAFELVYSPAIKDSTMRRYTISNALNLMQICKGKNVIISSAAERPLEIRGPYDVA
NLGLLFGLSESDAKAAVSTNCRAALLHGDTRKTAFGIISTVKKPRLLEGDEDCLPAPKKA
KQSRSVARRQGGVQWHNLGSLQPPPPGFRQFSCLSLPWTRIQERQLWISHQCIHTPKNRL
Download sequence
Identical sequences F7ESQ1
ENSCJAP00000020421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]