SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020423 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020423
Domain Number 1 Region: 21-229
Classification Level Classification E-value
Superfamily PHP domain-like 1.06e-45
Family RNase P subunit p30 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020423   Gene: ENSCJAG00000011045   Transcript: ENSCJAT00000021578
Sequence length 268
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:77656043:77692675:1 gene:ENSCJAG00000011045 transcript:ENSCJAT00000021578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFADLDLRAGSDVKALRGLVEAAAHLGYSVVAVNHVVDFKEKKQEIEKPVAVSELFTT
LPIVQGKSRPIKILTRLTIIVSDPSHCNVLRATSSRVRLYDVVAVFPKTEKLFHIACTHL
DVDLICITVTEKLPFYFKRPPINVAIDRGLAFELVYSPAIKDSTMRRYTISNALNLMQIC
KGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGDTRKTAFG
IISTVKKPRLLEGDEDCLPAPKKAKCEG
Download sequence
Identical sequences F7ESP6
ENSCJAP00000020423 ENSCJAP00000020411 XP_002756436.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]