SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020483 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020483
Domain Number 1 Region: 25-501
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-124
Family ALDH-like 0.0000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020483   Gene: ENSCJAG00000011102   Transcript: ENSCJAT00000021647
Sequence length 513
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:79340922:79399454:1 gene:ENSCJAG00000011102 transcript:ENSCJAT00000021647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLLINQPQYAWLKELGLGEENEGVYNGSWGGRGEVITTYCPANNEPIARVRQASVADY
EDTVKKAREAWKIWADIPAPKRGEIVRQIGNALREKIQVLGSLVSLEMGKILVEGVGEVQ
EYVDICDYAVGLSRMIGGPILPSERPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIA
LICGNVCLWKGAPTTSLISVAVTKIIAKVLEDNRLPGAICSLTCGGADIGTAMAKDERVN
LLSFTGSTPVGKQVALMVQERFGRSLLEVGGNNAIIAFEDADLNLVVPSALFAAVGTAGQ
RCTTARRLFVHESIHDEVNRLKKACTQIRVGNPWDSNVLYGPPHTKQAVSMFLGAVEEAK
KESGTEVYGGKVMDRPGNYVEPTMVTGLGHDASIAHTETFAPILYVFKFKNEEEVFAWNN
EVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFAGGTRGKHTGGGR
ESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences F7D0Z9
ENSCJAP00000020483 ENSCJAP00000020483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]