SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020573 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020573
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 4.19e-31
Family N-terminal domain of MutM-like DNA repair proteins 0.000000221
Further Details:      
 
Domain Number 2 Region: 133-246
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.2e-21
Family Middle domain of MutM-like DNA repair proteins 0.00000827
Further Details:      
 
Domain Number 3 Region: 250-292
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.27e-19
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020573   Gene: ENSCJAG00000011164   Transcript: ENSCJAT00000021745
Sequence length 393
Comment pep:novel chromosome:C_jacchus3.2.1:Y:611783:617734:1 gene:ENSCJAG00000011164 transcript:ENSCJAT00000021745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASQFVNEACRALVFGGCVEKSPVSRNPEVPFESSAYRISASARGKELRLTL
SPLPGAQPPQEPLALVFRFGMSGSFQLVPRGELPRHAHLRFYTAPPGPQLALCFVDIRRF
GHWDLGGKWQPGRGPCVLQEYEQFSSPSQWIRKLKNKAFYQPICEALLEQRLFNGIGNYL
WAEILCQLKIPPFEKARSVLEALQQPRLSLELTLSQKIKAKLQSPDLLELCHSVPKEVVQ
LGGKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGKGASPE
KRNPRPHSCPEDGVEDRPPPSKAPSRTLRAKRDLPERTATQRPKATSFQQDPEAPKIPKK
GRRKGRQAASGQRRPRKAKADTPSLELEGTSAS
Download sequence
Identical sequences F7GJP5
ENSCJAP00000020573 ENSCJAP00000020573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]