SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020827 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020827
Domain Number 1 Region: 13-166
Classification Level Classification E-value
Superfamily UBC-like 4.2e-44
Family UBC-related 0.0000000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020827   Gene: ENSCJAG00000011315   Transcript: ENSCJAT00000022014
Sequence length 259
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:35766696:35784008:-1 gene:ENSCJAG00000011315 transcript:ENSCJAT00000022014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTSTKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGY
YHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLS
FMVEKGPTLGSIETSDFTKRQLAAQSSAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSR
PQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAIPNLPGLQQANRHHGLLGGALANLFVIV
GFAAFAYTVKYVLRSIAQE
Download sequence
Identical sequences F7F3X4
XP_017829703.1.60252 XP_017829704.1.60252 ENSCJAP00000020827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]