SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020862 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020862
Domain Number 1 Region: 42-425
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.3e-56
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020862   Gene: ENSCJAG00000011293   Transcript: ENSCJAT00000022052
Sequence length 466
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:181515502:181560293:1 gene:ENSCJAG00000011293 transcript:ENSCJAT00000022052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDDHSRFVNCVRFSPD
GNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAXSWSPDSTHLLSASGDKTSKI
WDVNVNSVVSVFPMGTTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLRVIKGHS
KSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLI
SCSMDDTVRYTNLTLRDYSGQAVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFS
IDSPGYEPEVVAVHPGGDTVAVGGADGSVRLYSILGTTLKDEGKLLEAKGPVTDVAYSHD
GAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWT
LSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTITY
Download sequence
Identical sequences F7DYN2
ENSCJAP00000020862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]