SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021087 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021087
Domain Number 1 Region: 43-198
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 3.34e-83
Family Hedgehog (development protein), N-terminal signaling domain 0.000000076
Further Details:      
 
Domain Number 2 Region: 203-349
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.01e-40
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021087   Gene: ENSCJAG00000011469   Transcript: ENSCJAT00000022292
Sequence length 411
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:135439008:135445036:-1 gene:ENSCJAG00000011469 transcript:ENSCJAT00000022292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLARLRPRLRFCLVLLMLLVVPAAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKT
LGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMN
QWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYY
ESKAHVHCSVKSEHSAAAKTGGCFPAGAQVHLESGARVALSAVRPGDRVLAMGEDGSPTF
SDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQP
GQYVLVAGVPGLQPARVAAVSTHVALGAYAPLTRHGTLVVEDVVVSCFAAVADHHLAQLA
FWPLRLFHSLVWGSWTPGEGVHWYPQLLYRLGHLLLEEGSFHPLGMSETGS
Download sequence
Identical sequences F6TUL5
ENSCJAP00000021087 ENSCJAP00000021087 XP_002749847.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]