SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021218 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021218
Domain Number 1 Region: 54-129
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.67e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021218   Gene: ENSCJAG00000011549   Transcript: ENSCJAT00000022433
Sequence length 193
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:128179621:128182050:1 gene:ENSCJAG00000011549 transcript:ENSCJAT00000022433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGGALPRPAPPAPRVPVGCAARRRPASPELLRCSRRRRPANAETGSGAAAVARRNERER
NRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL
LAPAVRPSAPRGPPGPTSVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAE
RELLDFSSWLGGY
Download sequence
Identical sequences F6RN40
XP_009006952.1.60252 ENSCJAP00000021218 ENSCJAP00000021218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]