SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021388 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000021388
Domain Number - Region: 168-246
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.011
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021388   Gene: ENSCJAG00000011606   Transcript: ENSCJAT00000022609
Sequence length 727
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:201102692:201122916:-1 gene:ENSCJAG00000011606 transcript:ENSCJAT00000022609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRSQRLTRYSQGDDDGGSSSSGGSSVAGSQSTLFKDSPLRTLKRKSSNMKRPSPEPQL
GLSSDPHTSYYSESLVRESYIGSPRAAFLARSALEELHSDPDWGDHLRVRKRRGTGGSES
SRASGLVVGKAAEDFLGSSSGYSSEDDYVGYSDADLQSSGSRLQSVVSRVGSLLWMVATS
PGRLFRLLYWWAGTTWYRLTTAASLLDVFVLTRRFSSLKTFLWFLLLLLLLTCLTYGAWY
FYPYGLQTFHPALVSWWTAKDSRREHEGWESRDSSPHFQAEQHVLSRVHSLERRLEALAA
EFSSNWQKEAMRLERLELQQGTPAQGGSGGLSHEDTLALLEGLVSRREAALREDFRRETA
ARIQEELAALRAEHQQDSEDLFKKIVRASQESEAHIQQLKSEWQRTSMTQEAFRESSVKE
LRRLEDQLAGLQQELAALVQKQSSVADEVHLLPQQIQATRDDVESQFPAWISEFLARGGG
GRVGLLQREEMQAQLRDLENKILTHIAEMQGKSAREAAASLGLTLQKEGVIGVTEEQVHR
IVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRV
ILQPDVYPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFG
SSQNRRTEGCAREKGTSQECARPVASAQFQAPMMATYQVVELRILTNWGHPEYTCIYRFR
VHGEPTH
Download sequence
Identical sequences F6T6D4
ENSCJAP00000021388 ENSCJAP00000021388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]